PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14149.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 112aa    MW: 13265 Da    PI: 11.2342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14149.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.9e-18654148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                     +g+W+ eEd +l ++v+ +G g+W++ ar  g ++R++k+c++rw++yl
       KHN14149.1  6 KGPWSVEEDTILQNYVATHGDGRWNSLARSAGsLKRSGKSCRLRWLNYL 54
                     79**********************************************7 PP

2Myb_DNA-binding49.97.2e-1660103146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E+  +++++ ++G++ W++Iar+++ gRt++++k++w++
       KHN14149.1  60 RGNITLQEQITILELHSRWGNR-WSKIARHLP-GRTDNEIKNYWRT 103
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.064158IPR017930Myb domain
SuperFamilySSF466891.28E-293101IPR009057Homeodomain-like
SMARTSM007173.7E-14556IPR001005SANT/Myb domain
PfamPF002491.9E-16654IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-22761IPR009057Homeodomain-like
CDDcd001679.98E-10854No hitNo description
PROSITE profilePS5129418.1759109IPR017930Myb domain
SMARTSM007172.4E-1359107IPR001005SANT/Myb domain
PfamPF002493.4E-1460103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2262106IPR009057Homeodomain-like
CDDcd001673.77E-964103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
EEDIRKGPWS VEEDTILQNY VATHGDGRWN SLARSAGSLK RSGKSCRLRW LNYLRPDVRR  60
GNITLQEQIT ILELHSRWGN RWSKIARHLP GRTDNEIKNY WRTRVIKQAR NL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-24310324122MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520762.11e-73PREDICTED: transcription factor MYB108-like
SwissprotQ9LK953e-60MYB21_ARATH; Transcription factor MYB21
TrEMBLA0A0B2Q2B85e-77A0A0B2Q2B8_GLYSO; Transcription factor MYB21 (Fragment)
STRINGGLYMA03G38070.23e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-61myb domain protein 21
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]